PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10006263m
Common NameCARUB_v10006263mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family WRKY
Protein Properties Length: 183aa    MW: 21083.7 Da    PI: 8.0714
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10006263mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY103.98.8e-33100158159
                      ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      ldDgy+WrKYGqK+vk++ +prsYYrCt+++C+vkk+v+r a+dp+vv++tYeg Hnh+
  Carubv10006263m 100 LDDGYRWRKYGQKSVKNNAHPRSYYRCTYHTCNVKKQVQRLAKDPNVVVTTYEGIHNHP 158
                      59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.804.1E-3386158IPR003657WRKY domain
SuperFamilySSF1182907.98E-2992159IPR003657WRKY domain
PROSITE profilePS5081129.17295160IPR003657WRKY domain
SMARTSM007743.3E-38100159IPR003657WRKY domain
PfamPF031063.2E-26101158IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 183 aa     Download sequence    Send to blast
MDDREEDINP MLSLDVENNN TFSSFVDKTL MMMMPPLTFP SEVVAPSSSS TSWYPESLHA  60
PQPAPENDQI GDKGKNKEKE KRSRRVPRIA FQTRSDDDVL DDGYRWRKYG QKSVKNNAHP  120
RSYYRCTYHT CNVKKQVQRL AKDPNVVVTT YEGIHNHPCE KLMETLNPLL RQLQFLSSFS  180
NL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-2790157774Probable WRKY transcription factor 4
2lex_A1e-2790157774Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00539DAPTransfer from AT5G41570Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4048641e-167AF404864.1 Arabidopsis thaliana WRKY transcription factor 24 (WRKY24) mRNA, complete cds.
GenBankAK2275221e-167AK227522.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL14-13-N18.
GenBankBT0045951e-167BT004595.1 Arabidopsis thaliana At5g41570 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006284960.11e-136hypothetical protein CARUB_v10006263mg
SwissprotQ9FFS31e-104WRK24_ARATH; Probable WRKY transcription factor 24
TrEMBLR0H2X11e-136R0H2X1_9BRAS; Uncharacterized protein
STRINGAT5G41570.11e-101(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50928154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41570.12e-82WRKY DNA-binding protein 24